Communicate with Supplier? Supplier
Amy Cheng Ms. Amy Cheng
What can I do for you?
Chat Now Contact Supplier
Taizhou Volsen Chemical Co., Ltd.
HomeProductsPeptide ProductsTeriparatide Acetate 52232-67-4
Teriparatide Acetate 52232-67-4
  • Teriparatide Acetate 52232-67-4

Teriparatide Acetate 52232-67-4

    Unit Price: 1~1 USD
    Payment Type: T/T
    Incoterm: CIF
    Min. Order: 1 Kilogram
    Delivery Time: 15 Days

Basic Info

Model No.: 52232-67-4

Additional Info

Packaging: AS REQUIRED

Productivity: KGS

Brand: VOLSENCHEM

Transportation: Air

Place of Origin: CHINA

Supply Ability: TRUE MANUFACTURER

Certificate: GMP Peptide

Product Description

We, China Teriparatide Acetate 52232-67-4 Suppliers and China pTH (1-34) (human) | Teriparatide Manufacturers, provide China Parathyroid hormone fragment (1-34) product and the products related with China PARATHYROID HORMONE HUMAN 1-34

Thera. Category: Pharmaceutical Peptide

Cas No.: 52232-67-4

Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Molecular Formula: C172H278N52O47S2

Molecular Weight: 3890.49792

Purity: ≥98%

Packing: Export worthy packing

Material Safety Data Sheet: Available on request

Usage: Teriparatide is identical to a portion of human parathyrod hormone (PTH) and intermittent use activates osteoblasts more than osteoclates, which leads to an overall increase in bone.

Looking for ideal Teriparatide Acetate Manufacturer & supplier ? We have a wide selection at great prices to help you get creative. All the 52232-67-4 are quality guaranteed. We are China Origin Factory of CAS 52232-67-4. If you have any question, please feel free to contact us.

Product Categories : Peptide Products

Email to this supplier
  • Amy ChengMs. Amy Cheng
  • Your message must be between 20-8000 characters

Related Products List