Communicate with Supplier? Supplier
Amy Cheng Ms. Amy Cheng
What can I do for you?
Chat Now Contact Supplier
Taizhou Volsen Chemical Co., Ltd.
HomeProductsPeptide ProductsParathyroid Hormone Fragment (1-34) (CAS 52232-67-4)
Parathyroid Hormone Fragment (1-34) (CAS 52232-67-4)
  • Parathyroid Hormone Fragment (1-34) (CAS 52232-67-4)

Parathyroid Hormone Fragment (1-34) (CAS 52232-67-4)

    Unit Price: USD 1 / Kilogram
    Payment Type: T/T
    Incoterm: CIF
    Min. Order: 1 Kilogram
    Delivery Time: 15 Days

Basic Info

Model No.: 52232-67-4

Additional Info

Packaging: AS REQUIRED

Productivity: KGS

Brand: VOLSENCHEM

Transportation: Air

Place of Origin: CHINA

Supply Ability: TRUE MANUFACTURER

Certificate: GMP Peptide

Product Description


We are one of theTeriparatide Acetate

CAS 52232-67-4 suppliers in Chinese market. Teriparatide is a recombinant form of parathyroid hormone. It is an effective anabolic (i.e., bone growing) agent used in the treatment of some forms of osteoporosis and also occasionally used off-label to speed fracture healing. Teriparatide Acetate 52232-67-4 is known for fast action, steady quality and high purity. We are appreciated by lots of clients who we cooperated.



Thera. Category: Pharmaceutical Peptide

Cas No.: 52232-67-4

Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

Molecular Formula: C172H278N52O47S2

Molecular Weight: 3890.49792

Purity: ≥98%

Packing: Export worthy packing

Material Safety Data Sheet: Available on request

Usage: in the treatment of some forms of osteoporosis

Looking for ideal Parathyroid Hormone Fragment 52232-67-4 Manufacturer & supplier ? We have a wide selection at great prices to help you get creative. All the Parathyroid Hormone Fragment CAS 52232-67-4 are quality guaranteed. We are China Origin Factory of PTH 1-34 Human. If you have any question, please feel free to contact us.

Product Categories : Peptide Products

Email to this supplier
  • Amy ChengMs. Amy Cheng
  • Your message must be between 20-8000 characters

Related Products List